PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC5947_p2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Nin-like
Protein Properties Length: 826aa    MW: 92310.9 Da    PI: 5.952
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC5947_p2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.72.7e-29538588252
      RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                  k+i+l++l++yF++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  RrC5947_p2 538 DKNITLDVLRQYFAGSLKDAAKSIGVCPTTLKRICRQHGIQRWPSRKIKKV 588
                 69***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.132525608IPR003035RWP-RK domain
PfamPF020421.3E-25540588IPR003035RWP-RK domain
SuperFamilySSF542772.45E-22717808No hitNo description
Gene3DG3DSA:3.10.20.2402.0E-21723804No hitNo description
PROSITE profilePS5174529.64724807IPR000270PB1 domain
SMARTSM006664.6E-27724807IPR000270PB1 domain
PfamPF005643.2E-19725806IPR000270PB1 domain
CDDcd064072.71E-44726806No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 826 aa     Download sequence    Send to blast
MEDSFLQSEN NTVMDTEFMD GLLLDGCWLE TTDGSEFLNL TPPTPFDPSS FIWSPPQDTS  60
AICTSGAVSQ TYGQDCADEF QWNKRWWIGP GGGGSSVTER LVQAVEHIKD YTTERGSLIQ  120
LWVPVNRGGK RVLTTKEQPF SHDPMCQRLA NYREISVNYH FSAEQDDSKA LAGLPGRVFL  180
GKLPEWTPDV RFFKSEEYPR VQHAQDCDVR GTLAIPVFEQ GSKICLGVIE VVMTTEMVKL  240
KPELESICRA LQAVDLRSTE LPVPPSLKGC DLSYKAALPE IRNLLRCACE THKLPLAQTW  300
VSCLQQSKSG CRHNDENYIH CVSTIDDACY LGDPTVREFQ EACSEHHLLK GQGVAGQAFL  360
TNGPCFSPDV SNYKKSEYPL SHHANMFGLH GAVAIRLRCI HTGSADFVLE FFLPKDCDNL  420
EEQRKMLNAL STIMAHVPRS LRTVTDKEME EESEVMIERE EIVTPKIENN NNTPELLHHH  480
PHQSLGMVFD GGEKQPHDGF GLKRGYDFTR DNADINESST FTSGGFNSMA EKKRTKADKN  540
ITLDVLRQYF AGSLKDAAKS IGVCPTTLKR ICRQHGIQRW PSRKIKKVGH SLQKIQRVID  600
SVEGVSGPLP IGSFYANFPN LASQEPPQQA KTSPPSPPPP PPLQLSKSPV SQYSHSSSSS  660
QCCSSETQLN SSAATTHPSQ ADAFKKVSSE VDLQSSVLTL SSLENIPQGQ GTHLLSSSSQ  720
DDDSLRIKVS YGEEKIRFRM KNSRRLSDLL WEIGKRFSIE DMSRYDLKYL DEDNEWVLLT  780
CDEDVEECVD VCRTTPSHTI KLLLHASASS HHFPERSSPT GYTLWQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00154DAPTransfer from AT1G20640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013717640.10.0PREDICTED: protein NLP4
RefseqXP_013717638.10.0PREDICTED: protein NLP4
RefseqXP_013717637.10.0PREDICTED: protein NLP4
RefseqXP_013585974.10.0PREDICTED: protein NLP4 isoform X1
RefseqXP_013585973.10.0PREDICTED: protein NLP4 isoform X1
SwissprotQ9LE380.0NLP4_ARATH; Protein NLP4
TrEMBLA0A0D3CBU50.0A0A0D3CBU5_BRAOL; Uncharacterized protein
STRINGBra025834.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34612663
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.20.0Nin-like family protein